SPAG8 purified MaxPab mouse polyclonal antibody (B01P)
  • SPAG8 purified MaxPab mouse polyclonal antibody (B01P)

SPAG8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026206-B01P
SPAG8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SPAG8 protein.
Información adicional
Size 50 ug
Gene Name SPAG8
Gene Alias BS-84|HSD-1|MGC26201|SMP1|SPAG3|hSMP-1
Gene Description sperm associated antigen 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq METNGSTEGSRSRSRSLDIQPSSEGLGPTSEPFPSSDDSPRSALAAATAAAAAAASAAAATAAFTTAKAAALSTKTPAPCSEFMEPSSDPSLLGEPCAGPGFTHNIAHGSLGFEPVYVSCIAQDTCTTTDHSSNPGPVPGSSSGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVLNYTSWSQHCPWEPQKQPPWEFLQVLEPGA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPAG8 (AAH19247.1, 1 a.a. ~ 501 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26206

Enviar un mensaje


SPAG8 purified MaxPab mouse polyclonal antibody (B01P)

SPAG8 purified MaxPab mouse polyclonal antibody (B01P)