PTPN22 monoclonal antibody (M01), clone 4F6
  • PTPN22 monoclonal antibody (M01), clone 4F6

PTPN22 monoclonal antibody (M01), clone 4F6

Ref: AB-H00026191-M01
PTPN22 monoclonal antibody (M01), clone 4F6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PTPN22.
Información adicional
Size 100 ug
Gene Name PTPN22
Gene Alias LYP|Lyp1|Lyp2|PEP|PTPN8
Gene Description protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTPN22 (AAH17785, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26191
Clone Number 4F6
Iso type IgG2a Kappa

Enviar un mensaje


PTPN22 monoclonal antibody (M01), clone 4F6

PTPN22 monoclonal antibody (M01), clone 4F6