PTPN22 purified MaxPab mouse polyclonal antibody (B01P)
  • PTPN22 purified MaxPab mouse polyclonal antibody (B01P)

PTPN22 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026191-B01P
PTPN22 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PTPN22 protein.
Información adicional
Size 50 ug
Gene Name PTPN22
Gene Alias LYP|Lyp1|Lyp2|PEP|PTPN8
Gene Description protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAIDYTWMLLKDGSQAKH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTPN22 (AAH71670.1, 1 a.a. ~ 752 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26191

Enviar un mensaje


PTPN22 purified MaxPab mouse polyclonal antibody (B01P)

PTPN22 purified MaxPab mouse polyclonal antibody (B01P)