FBXW2 purified MaxPab mouse polyclonal antibody (B01P)
  • FBXW2 purified MaxPab mouse polyclonal antibody (B01P)

FBXW2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026190-B01P
FBXW2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FBXW2 protein.
Información adicional
Size 50 ug
Gene Name FBXW2
Gene Alias FBW2|Fwd2|MGC117371|Md6
Gene Description F-box and WD repeat domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLLPLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWKKVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQCVYGIQTHTCAAVKFDEQKLVTGSFDNTVACWEWSSGARTQHFRGHTGAVFSVDYNDELDILVSGSADFTVKVWAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXW2 (ABM86476.1, 1 a.a. ~ 454 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26190

Enviar un mensaje


FBXW2 purified MaxPab mouse polyclonal antibody (B01P)

FBXW2 purified MaxPab mouse polyclonal antibody (B01P)