SENP3 polyclonal antibody (A01)
  • SENP3 polyclonal antibody (A01)

SENP3 polyclonal antibody (A01)

Ref: AB-H00026168-A01
SENP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SENP3.
Información adicional
Size 50 uL
Gene Name SENP3
Gene Alias DKFZp586K0919|DKFZp762A152|SMT3IP1|SSP3
Gene Description SUMO1/sentrin/SMT3 specific peptidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SENP3 (NP_056485, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26168

Enviar un mensaje


SENP3 polyclonal antibody (A01)

SENP3 polyclonal antibody (A01)