Ver mas grande
SENP3 polyclonal antibody (A01)
AB-H00026168-A01
Producto nuevo
SENP3 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | SENP3 |
| Gene Alias | DKFZp586K0919|DKFZp762A152|SMT3IP1|SSP3 |
| Gene Description | SUMO1/sentrin/SMT3 specific peptidase 3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | EKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQN |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SENP3 (NP_056485, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 26168 |
Más información
Mouse polyclonal antibody raised against a partial recombinant SENP3.