NAT9 purified MaxPab mouse polyclonal antibody (B01P)
  • NAT9 purified MaxPab mouse polyclonal antibody (B01P)

NAT9 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026151-B01P
NAT9 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NAT9 protein.
Información adicional
Size 50 ug
Gene Name NAT9
Gene Alias DKFZp564C103|EBSP
Gene Description N-acetyltransferase 9 (GCN5-related, putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NAT9 (NP_056469.2, 1 a.a. ~ 207 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26151

Enviar un mensaje


NAT9 purified MaxPab mouse polyclonal antibody (B01P)

NAT9 purified MaxPab mouse polyclonal antibody (B01P)