FGFR1OP2 polyclonal antibody (A01)
  • FGFR1OP2 polyclonal antibody (A01)

FGFR1OP2 polyclonal antibody (A01)

Ref: AB-H00026127-A01
FGFR1OP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FGFR1OP2.
Información adicional
Size 50 uL
Gene Name FGFR1OP2
Gene Alias DKFZp564O1863|HSPC123-like
Gene Description FGFR1 oncogene partner 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQHSKIDMVHRNKSEGFFLDASRHILEAPQHGLERRHLEANQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGFR1OP2 (NP_056448, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26127

Enviar un mensaje


FGFR1OP2 polyclonal antibody (A01)

FGFR1OP2 polyclonal antibody (A01)