AB-H00026118-M01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | WSB1 |
Gene Alias | SWIP1|WSB-1 |
Gene Description | WD repeat and SOCS box-containing 1 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | S-ELISA,ELISA |
Immunogen Prot. Seq | QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFG |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | WSB1 (AAH21110.1, 53 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 26118 |
Clone Number | 3E10 |
Iso type | IgG2a Kappa |