PYGO1 monoclonal antibody (M13), clone 3E1
  • PYGO1 monoclonal antibody (M13), clone 3E1

PYGO1 monoclonal antibody (M13), clone 3E1

Ref: AB-H00026108-M13
PYGO1 monoclonal antibody (M13), clone 3E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PYGO1.
Información adicional
Size 100 ug
Gene Name PYGO1
Gene Alias DKFZp547G0910
Gene Description pygopus homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PYGO1 (NP_056432, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26108
Clone Number 3E1
Iso type IgG1 Kappa

Enviar un mensaje


PYGO1 monoclonal antibody (M13), clone 3E1

PYGO1 monoclonal antibody (M13), clone 3E1