HERC4 polyclonal antibody (A01)
  • HERC4 polyclonal antibody (A01)

HERC4 polyclonal antibody (A01)

Ref: AB-H00026091-A01
HERC4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HERC4.
Información adicional
Size 50 uL
Gene Name HERC4
Gene Alias DKFZp564G092|KIAA1593
Gene Description hect domain and RLD 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VKGNWYPYNGQCLPDIDSEEYFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCPNPTKQIWTVNEALIQKWLSYPSGRFPVEIANEIDGTFSSSGCLNGSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HERC4 (NP_071362, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26091

Enviar un mensaje


HERC4 polyclonal antibody (A01)

HERC4 polyclonal antibody (A01)