KLK13 monoclonal antibody (M01), clone 1G9
  • KLK13 monoclonal antibody (M01), clone 1G9

KLK13 monoclonal antibody (M01), clone 1G9

Ref: AB-H00026085-M01
KLK13 monoclonal antibody (M01), clone 1G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLK13.
Información adicional
Size 100 ug
Gene Name KLK13
Gene Alias DKFZp586J1923|KLK-L4|KLKL4
Gene Description kallikrein-related peptidase 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ANIQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLK13 (NP_056411.1, 179 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26085
Clone Number 1G9
Iso type IgG2b Kappa

Enviar un mensaje


KLK13 monoclonal antibody (M01), clone 1G9

KLK13 monoclonal antibody (M01), clone 1G9