DECR2 monoclonal antibody (M03), clone 4A7
  • DECR2 monoclonal antibody (M03), clone 4A7

DECR2 monoclonal antibody (M03), clone 4A7

Ref: AB-H00026063-M03
DECR2 monoclonal antibody (M03), clone 4A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DECR2.
Información adicional
Size 100 ug
Gene Name DECR2
Gene Alias PDCR|SDR17C1
Gene Description 2,4-dienoyl CoA reductase 2, peroxisomal
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DECR2 (AAH10740.1, 49 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26063
Clone Number 4A7
Iso type IgG2a Kappa

Enviar un mensaje


DECR2 monoclonal antibody (M03), clone 4A7

DECR2 monoclonal antibody (M03), clone 4A7