APPL polyclonal antibody (A01)
  • APPL polyclonal antibody (A01)

APPL polyclonal antibody (A01)

Ref: AB-H00026060-A01
APPL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant APPL.
Información adicional
Size 50 uL
Gene Name APPL1
Gene Alias APPL|DIP13alpha
Gene Description adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APPL (NP_036228, 611 a.a. ~ 708 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26060

Enviar un mensaje


APPL polyclonal antibody (A01)

APPL polyclonal antibody (A01)