RAB11FIP5 monoclonal antibody (M02), clone 3A8
  • RAB11FIP5 monoclonal antibody (M02), clone 3A8

RAB11FIP5 monoclonal antibody (M02), clone 3A8

Ref: AB-H00026056-M02
RAB11FIP5 monoclonal antibody (M02), clone 3A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB11FIP5.
Información adicional
Size 100 ug
Gene Name RAB11FIP5
Gene Alias DKFZp434H018|GAF1|KIAA0857|RIP11|pp75
Gene Description RAB11 family interacting protein 5 (class I)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB11FIP5 (NP_056285.1, 554 a.a. ~ 652 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26056
Clone Number 3A8
Iso type IgG2b Kappa

Enviar un mensaje


RAB11FIP5 monoclonal antibody (M02), clone 3A8

RAB11FIP5 monoclonal antibody (M02), clone 3A8