RAB11FIP5 purified MaxPab mouse polyclonal antibody (B01P)
  • RAB11FIP5 purified MaxPab mouse polyclonal antibody (B01P)

RAB11FIP5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026056-B01P
RAB11FIP5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAB11FIP5 protein.
Información adicional
Size 50 ug
Gene Name RAB11FIP5
Gene Alias DKFZp434H018|GAF1|KIAA0857|RIP11|pp75
Gene Description RAB11 family interacting protein 5 (class I)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVVEKTHGCPEWREECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGVDKFLGQATVALDEVFGAGRAQHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSAMFDLSMKDKPRSPFSKIRDKMKGKKKYDLESASAILPSSAIEDPDLGSLGKMGKAKGFFLRNKLRKSSLTQSNTSLGSDS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB11FIP5 (AAH35013, 1 a.a. ~ 652 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26056

Enviar un mensaje


RAB11FIP5 purified MaxPab mouse polyclonal antibody (B01P)

RAB11FIP5 purified MaxPab mouse polyclonal antibody (B01P)