SENP6 monoclonal antibody (M01), clone 4B7
  • SENP6 monoclonal antibody (M01), clone 4B7

SENP6 monoclonal antibody (M01), clone 4B7

Ref: AB-H00026054-M01
SENP6 monoclonal antibody (M01), clone 4B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SENP6.
Información adicional
Size 100 ug
Gene Name SENP6
Gene Alias FLJ11355|FLJ11887|KIAA0389|KIAA0797|SSP1|SUSP1
Gene Description SUMO1/sentrin specific peptidase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDEDSETSKGKKLNRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SENP6 (NP_056386, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26054
Clone Number 4B7
Iso type IgG2a Kappa

Enviar un mensaje


SENP6 monoclonal antibody (M01), clone 4B7

SENP6 monoclonal antibody (M01), clone 4B7