SETBP1 purified MaxPab mouse polyclonal antibody (B01P)
  • SETBP1 purified MaxPab mouse polyclonal antibody (B01P)

SETBP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026040-B01P
SETBP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SETBP1 protein.
Información adicional
Size 50 ug
Gene Name SETBP1
Gene Alias KIAA0437|SEB
Gene Description SET binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEEDELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQIKDSSKEEVWKRRGGQGIPFKKQFLSQERAMCFSCPRNPFPAKPGSLTLPFHSEPAVWAQEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SETBP1 (AAH62338.1, 1 a.a. ~ 242 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26040

Enviar un mensaje


SETBP1 purified MaxPab mouse polyclonal antibody (B01P)

SETBP1 purified MaxPab mouse polyclonal antibody (B01P)