SUSD5 monoclonal antibody (M09), clone 4G3
  • SUSD5 monoclonal antibody (M09), clone 4G3

SUSD5 monoclonal antibody (M09), clone 4G3

Ref: AB-H00026032-M09
SUSD5 monoclonal antibody (M09), clone 4G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SUSD5.
Información adicional
Size 100 ug
Gene Name SUSD5
Gene Alias KIAA0527
Gene Description sushi domain containing 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TTVCSKGSGEQQIMRAVDVRIESNPVPGGTYSALCIKDEEKPCGDPPSFPHTILQGRTGLEMGDELLYVCAPGHIMGHRETAFTLLCNSCGEWYGLVQAC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUSD5 (XP_171054, 284 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26032
Clone Number 4G3
Iso type IgG2a Kappa

Enviar un mensaje


SUSD5 monoclonal antibody (M09), clone 4G3

SUSD5 monoclonal antibody (M09), clone 4G3