RNF167 polyclonal antibody (A01)
  • RNF167 polyclonal antibody (A01)

RNF167 polyclonal antibody (A01)

Ref: AB-H00026001-A01
RNF167 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF167.
Información adicional
Size 50 uL
Gene Name RNF167
Gene Alias 5730408C10Rik|DKFZp566H073|LP2254|RING105
Gene Description ring finger protein 167
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYLRALFVYEKGARVLLVPDNTFPLGY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF167 (NP_056343, 78 a.a. ~ 172 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26001

Enviar un mensaje


RNF167 polyclonal antibody (A01)

RNF167 polyclonal antibody (A01)