CLIP3 monoclonal antibody (M09), clone 4C11
  • CLIP3 monoclonal antibody (M09), clone 4C11

CLIP3 monoclonal antibody (M09), clone 4C11

Ref: AB-H00025999-M09
CLIP3 monoclonal antibody (M09), clone 4C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLIP3.
Información adicional
Size 100 ug
Gene Name CLIP3
Gene Alias CLIPR-59|CLIPR59|DKFZp586N1922|FLJ33413|RSNL1
Gene Description CAP-GLY domain containing linker protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLIP3 (NP_056341, 447 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25999
Clone Number 4C11
Iso type IgG1 Kappa

Enviar un mensaje


CLIP3 monoclonal antibody (M09), clone 4C11

CLIP3 monoclonal antibody (M09), clone 4C11