LRRC54 purified MaxPab mouse polyclonal antibody (B01P)
  • LRRC54 purified MaxPab mouse polyclonal antibody (B01P)

LRRC54 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025987-B01P
LRRC54 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LRRC54 protein.
Información adicional
Size 50 ug
Gene Name TSKU
Gene Alias E2IG4|LRRC54|TSK
Gene Description tsukushin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPWPLLLLLAVSGAQTTRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDTAHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHRLVPHPTRAGLPAPTIQSLNLAWNRLHAVPNLRDLPLRYLSLDGNPLAVIGPGAFAGLGGLTHLSLASLQRLPELAPSGFRELPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LRRC54 (NP_056331.2, 1 a.a. ~ 353 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25987

Enviar un mensaje


LRRC54 purified MaxPab mouse polyclonal antibody (B01P)

LRRC54 purified MaxPab mouse polyclonal antibody (B01P)