LRRC54 polyclonal antibody (A01)
  • LRRC54 polyclonal antibody (A01)

LRRC54 polyclonal antibody (A01)

Ref: AB-H00025987-A01
LRRC54 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LRRC54.
Información adicional
Size 50 uL
Gene Name TSKU
Gene Alias E2IG4|LRRC54|TSK
Gene Description tsukushin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PGLQVLDLSGNPKLNWAGAEVFSGLSSLQELDLSGTNLVPLPEALLLHLPALQSVSVGQDVRCRRLVREGTYPRRPGSSPKVALHCVDTRDSAARGPTIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LRRC54 (NP_056331, 254 a.a. ~ 353 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25987

Enviar un mensaje


LRRC54 polyclonal antibody (A01)

LRRC54 polyclonal antibody (A01)