SH2B1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SH2B1 purified MaxPab rabbit polyclonal antibody (D01P)

SH2B1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00025970-D01P
SH2B1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SH2B1 protein.
Información adicional
Size 100 ug
Gene Name SH2B1
Gene Alias DKFZp547G1110|FLJ30542|KIAA1299|SH2-B|SH2B
Gene Description SH2B adaptor protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SH2B1 (AAH10704.1, 1 a.a. ~ 426 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25970

Enviar un mensaje


SH2B1 purified MaxPab rabbit polyclonal antibody (D01P)

SH2B1 purified MaxPab rabbit polyclonal antibody (D01P)