SH2B purified MaxPab mouse polyclonal antibody (B01P)
  • SH2B purified MaxPab mouse polyclonal antibody (B01P)

SH2B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025970-B01P
SH2B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SH2B protein.
Información adicional
Size 50 ug
Gene Name SH2B1
Gene Alias DKFZp547G1110|FLJ30542|KIAA1299|SH2-B|SH2B
Gene Description SH2B adaptor protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SH2B (AAH10704.1, 1 a.a. ~ 426 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25970

Enviar un mensaje


SH2B purified MaxPab mouse polyclonal antibody (B01P)

SH2B purified MaxPab mouse polyclonal antibody (B01P)