NUDT13 monoclonal antibody (M02), clone 1A9
  • NUDT13 monoclonal antibody (M02), clone 1A9

NUDT13 monoclonal antibody (M02), clone 1A9

Ref: AB-H00025961-M02
NUDT13 monoclonal antibody (M02), clone 1A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NUDT13.
Información adicional
Size 100 ug
Gene Name NUDT13
Gene Alias -
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq SLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFYLFHSLAPLLQTSAHQYLAPRHSLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWFALDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUDT13 (NP_056985.3, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25961
Clone Number 1A9
Iso type IgG2b Kappa

Enviar un mensaje


NUDT13 monoclonal antibody (M02), clone 1A9

NUDT13 monoclonal antibody (M02), clone 1A9