FAM98A purified MaxPab mouse polyclonal antibody (B01P)
  • FAM98A purified MaxPab mouse polyclonal antibody (B01P)

FAM98A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025940-B01P
FAM98A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FAM98A protein.
Información adicional
Size 50 ug
Gene Name FAM98A
Gene Alias DKFZp564F0522|DKFZp686O03192
Gene Description family with sequence similarity 98, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQAIANEYEVRRKLLIKRLDVTVQSFGWSDRAKSQTEKLAKVYQPKRS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FAM98A (NP_056290.3, 1 a.a. ~ 518 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25940

Enviar un mensaje


FAM98A purified MaxPab mouse polyclonal antibody (B01P)

FAM98A purified MaxPab mouse polyclonal antibody (B01P)