SAMHD1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SAMHD1 purified MaxPab rabbit polyclonal antibody (D01P)

SAMHD1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00025939-D01P
SAMHD1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SAMHD1 protein.
Información adicional
Size 100 ug
Gene Name SAMHD1
Gene Alias DCIP|HDDC1|MOP-5|SBBI88
Gene Description SAM domain and HD domain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVME
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SAMHD1 (NP_056289.2, 1 a.a. ~ 626 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25939

Enviar un mensaje


SAMHD1 purified MaxPab rabbit polyclonal antibody (D01P)

SAMHD1 purified MaxPab rabbit polyclonal antibody (D01P)