C1orf48 polyclonal antibody (A01)
  • C1orf48 polyclonal antibody (A01)

C1orf48 polyclonal antibody (A01)

Ref: AB-H00025936-A01
C1orf48 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C1orf48.
Información adicional
Size 50 uL
Gene Name NSL1
Gene Alias C1orf48|DC8|DKFZp566O1646|MIS14
Gene Description NSL1, MIND kinetochore complex component, homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KEISEAMKSLPALIEQGEGFSQVLRMQPVIHLQRIHQEVFSSCHRKPDAKPENFITQIETTPTETASRKTSDVVLKRKQTKDCPQRKWYPLRPKKINL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C1orf48 (NP_056286, 182 a.a. ~ 279 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25936

Enviar un mensaje


C1orf48 polyclonal antibody (A01)

C1orf48 polyclonal antibody (A01)