THUMPD3 MaxPab mouse polyclonal antibody (B01P)
  • THUMPD3 MaxPab mouse polyclonal antibody (B01P)

THUMPD3 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025917-B01P
THUMPD3 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human THUMPD3 protein.
Información adicional
Size 50 ug
Gene Name THUMPD3
Gene Alias DKFZp434F091
Gene Description THUMP domain containing 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCDIEEATNQLLDVNLHENQKSVQVTESDLGSESELLVTIGATVPTGFEQTAADEVREKLGSSCKISRDRGKIYFVISVESLAQVHCLRSVDNLFVVVQEFQDYQFKQTKEEVLKDFEDLAGKLPWSNPLKVWKINASFKKKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHALDSHILDYYENPAIKEDVSTLIGDDLASCKDETDESSKEETEPQVLKFRVTCNRAGEKHCFTSNEAARDFGGAVQD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen THUMPD3 (AAH01622, 1 a.a. ~ 507 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25917

Enviar un mensaje


THUMPD3 MaxPab mouse polyclonal antibody (B01P)

THUMPD3 MaxPab mouse polyclonal antibody (B01P)