MTHFD1L monoclonal antibody (M01), clone 1E8
  • MTHFD1L monoclonal antibody (M01), clone 1E8

MTHFD1L monoclonal antibody (M01), clone 1E8

Ref: AB-H00025902-M01
MTHFD1L monoclonal antibody (M01), clone 1E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MTHFD1L.
Información adicional
Size 100 ug
Gene Name MTHFD1L
Gene Alias DKFZp586G1517|FLJ21145|FTHFSDC1|MTC1THFS|dJ292B18.2
Gene Description methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTHFD1L (NP_056255, 801 a.a. ~ 899 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25902
Clone Number 1E8
Iso type IgG2a Kappa

Enviar un mensaje


MTHFD1L monoclonal antibody (M01), clone 1E8

MTHFD1L monoclonal antibody (M01), clone 1E8