INTS7 purified MaxPab mouse polyclonal antibody (B01P)
  • INTS7 purified MaxPab mouse polyclonal antibody (B01P)

INTS7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025896-B01P
INTS7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human INTS7 protein.
Información adicional
Size 50 ug
Gene Name INTS7
Gene Alias C1orf73|DKFZp434B168|INT7
Gene Description integrator complex subunit 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MASNSTKSFLADAGYGEQELDANSALMELDKGLRSGKLGEQCEAVVRFPRLFQKYPFPILINSAFLKLADVFRVGNNFLRLCVLKVTQQSEKHLEKILNVDEFVKRIFSVIHSNDPVARAITLRMLGSLASIIPERKNAHHSIRQSLDSHDNVEVEAAVFAAANFSAQSKDFAVGICNKISEMIQGLATPVDLKLKLIPILQHMHHDAILASSARQLLQQLVTSYPSTKMVIVSLHTFTLLAASSLVDTPKQIQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen INTS7 (NP_056249.1, 1 a.a. ~ 962 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25896

Enviar un mensaje


INTS7 purified MaxPab mouse polyclonal antibody (B01P)

INTS7 purified MaxPab mouse polyclonal antibody (B01P)