FAM119B purified MaxPab mouse polyclonal antibody (B01P)
  • FAM119B purified MaxPab mouse polyclonal antibody (B01P)

FAM119B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025895-B01P
FAM119B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FAM119B protein.
Información adicional
Size 50 ug
Gene Name FAM119B
Gene Alias DKFZp586D0919
Gene Description family with sequence similarity 119, member B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FAM119B (NP_056248.2, 1 a.a. ~ 226 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25895

Enviar un mensaje


FAM119B purified MaxPab mouse polyclonal antibody (B01P)

FAM119B purified MaxPab mouse polyclonal antibody (B01P)