PLEKHG4 purified MaxPab mouse polyclonal antibody (B01P)
  • PLEKHG4 purified MaxPab mouse polyclonal antibody (B01P)

PLEKHG4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025894-B01P
PLEKHG4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PLEKHG4 protein.
Información adicional
Size 50 ug
Gene Name PLEKHG4
Gene Alias DKFZp434I216|PRTPHN1|SCA4
Gene Description pleckstrin homology domain containing, family G (with RhoGef domain) member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MHVKDPGPPRPPAGATQDEELQGSPLSRKFQLPPAADESGDAQRGTVESSSVLSEGPGPSGVESLLCPMSSHLSLAQGESDTPGVGLVGDPGPSRAMPSGLSPGALDSDPVGLGDPLSEISKLLEAAPSGSGLPKPADCLLAQDLCWELLASGMATLPGTRDVQGRAVLLLCAHSPAWLQSECSSQELIRLLLYLRSIPRPEVQALGLTVLVDARICAPSSSLFSGLSQLQEAAPGAVYQVLLVGSTLLKEVPSG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLEKHG4 (AAH82974.1, 1 a.a. ~ 1151 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25894

Enviar un mensaje


PLEKHG4 purified MaxPab mouse polyclonal antibody (B01P)

PLEKHG4 purified MaxPab mouse polyclonal antibody (B01P)