TRIM58 polyclonal antibody (A01)
  • TRIM58 polyclonal antibody (A01)

TRIM58 polyclonal antibody (A01)

Ref: AB-H00025893-A01
TRIM58 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRIM58.
Información adicional
Size 50 uL
Gene Name TRIM58
Gene Alias BIA2|DKFZp434C091
Gene Description tripartite motif-containing 58
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HYWEVLVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAGEISFYNVTDGSYIYTFNQLFSGLLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM58 (NP_056246, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25893

Enviar un mensaje


TRIM58 polyclonal antibody (A01)

TRIM58 polyclonal antibody (A01)