CHRDL2 purified MaxPab mouse polyclonal antibody (B01P)
  • CHRDL2 purified MaxPab mouse polyclonal antibody (B01P)

CHRDL2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025884-B01P
CHRDL2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CHRDL2 protein.
Información adicional
Size 50 ug
Gene Name CHRDL2
Gene Alias BNF1|CHL2|DKFZp586N2124|FKSG37
Gene Description chordin-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSEGAHVSCYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFSAHELFPSRLPNQCVLCSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLHGVRHPQDPCSSDAGRKRGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKACVHG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHRDL2 (AAI53101.1, 1 a.a. ~ 451 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25884

Enviar un mensaje


CHRDL2 purified MaxPab mouse polyclonal antibody (B01P)

CHRDL2 purified MaxPab mouse polyclonal antibody (B01P)