DFNB31 polyclonal antibody (A01)
  • DFNB31 polyclonal antibody (A01)

DFNB31 polyclonal antibody (A01)

Ref: AB-H00025861-A01
DFNB31 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DFNB31.
Información adicional
Size 50 uL
Gene Name DFNB31
Gene Alias CIP98|DKFZp434N014|KIAA1526|RP11-9M16.1|USH2D|WHRN|WI
Gene Description deafness, autosomal recessive 31
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DFNB31 (NP_056219, 808 a.a. ~ 907 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25861

Enviar un mensaje


DFNB31 polyclonal antibody (A01)

DFNB31 polyclonal antibody (A01)