COG4 monoclonal antibody (M04), clone 3B8
  • COG4 monoclonal antibody (M04), clone 3B8

COG4 monoclonal antibody (M04), clone 3B8

Ref: AB-H00025839-M04
COG4 monoclonal antibody (M04), clone 3B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COG4.
Información adicional
Size 100 ug
Gene Name COG4
Gene Alias COD1|DKFZp586E1519
Gene Description component of oligomeric golgi complex 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq ELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRLRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COG4 (NP_056201, 686 a.a. ~ 785 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25839
Clone Number 3B8
Iso type IgG2a Kappa

Enviar un mensaje


COG4 monoclonal antibody (M04), clone 3B8

COG4 monoclonal antibody (M04), clone 3B8