COG4 polyclonal antibody (A01)
  • COG4 polyclonal antibody (A01)

COG4 polyclonal antibody (A01)

Ref: AB-H00025839-A01
COG4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COG4.
Información adicional
Size 50 uL
Gene Name COG4
Gene Alias COD1|DKFZp586E1519
Gene Description component of oligomeric golgi complex 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRLRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COG4 (NP_056201, 686 a.a. ~ 785 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25839

Enviar un mensaje


COG4 polyclonal antibody (A01)

COG4 polyclonal antibody (A01)