RAB26 monoclonal antibody (M01), clone 2H1
  • RAB26 monoclonal antibody (M01), clone 2H1

RAB26 monoclonal antibody (M01), clone 2H1

Ref: AB-H00025837-M01
RAB26 monoclonal antibody (M01), clone 2H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB26.
Información adicional
Size 100 ug
Gene Name RAB26
Gene Alias V46133
Gene Description RAB26, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKELKRRSMKAPSEPRFRLHDYVKREGRGASCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB26 (NP_055168, 157 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25837
Clone Number 2H1
Iso type IgG2a Kappa

Enviar un mensaje


RAB26 monoclonal antibody (M01), clone 2H1

RAB26 monoclonal antibody (M01), clone 2H1