HECTD1 monoclonal antibody (M08), clone 1C7
  • HECTD1 monoclonal antibody (M08), clone 1C7

HECTD1 monoclonal antibody (M08), clone 1C7

Ref: AB-H00025831-M08
HECTD1 monoclonal antibody (M08), clone 1C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HECTD1.
Información adicional
Size 100 ug
Gene Name HECTD1
Gene Alias FLJ38315|KIAA1131
Gene Description HECT domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HECTD1 (NP_056197, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25831
Clone Number 1C7
Iso type IgG2a Kappa

Enviar un mensaje


HECTD1 monoclonal antibody (M08), clone 1C7

HECTD1 monoclonal antibody (M08), clone 1C7