HECTD1 polyclonal antibody (A01)
  • HECTD1 polyclonal antibody (A01)

HECTD1 polyclonal antibody (A01)

Ref: AB-H00025831-A01
HECTD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HECTD1.
Información adicional
Size 50 uL
Gene Name HECTD1
Gene Alias FLJ38315|KIAA1131
Gene Description HECT domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKIFLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HECTD1 (NP_056197, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25831

Enviar un mensaje


HECTD1 polyclonal antibody (A01)

HECTD1 polyclonal antibody (A01)