SULT4A1 monoclonal antibody (M02), clone 3C1
  • SULT4A1 monoclonal antibody (M02), clone 3C1

SULT4A1 monoclonal antibody (M02), clone 3C1

Ref: AB-H00025830-M02
SULT4A1 monoclonal antibody (M02), clone 3C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SULT4A1.
Información adicional
Size 100 ug
Gene Name SULT4A1
Gene Alias BR-STL-1|BRSTL1|DJ388M5.3|MGC40032|NST|SULTX3|hBR-STL-1
Gene Description sulfotransferase family 4A, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SULT4A1 (NP_055166.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25830
Clone Number 3C1
Iso type IgG2a Kappa

Enviar un mensaje


SULT4A1 monoclonal antibody (M02), clone 3C1

SULT4A1 monoclonal antibody (M02), clone 3C1