PRDX5 purified MaxPab mouse polyclonal antibody (B01P)
  • PRDX5 purified MaxPab mouse polyclonal antibody (B01P)

PRDX5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025824-B01P
PRDX5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRDX5 protein.
Información adicional
Size 50 ug
Gene Name PRDX5
Gene Alias ACR1|AOEB166|B166|MGC117264|MGC142283|MGC142285|PLP|PMP20|PRDX6|PRXV|SBBI10
Gene Description peroxiredoxin 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRDX5 (NP_036226.1, 1 a.a. ~ 214 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25824

Enviar un mensaje


PRDX5 purified MaxPab mouse polyclonal antibody (B01P)

PRDX5 purified MaxPab mouse polyclonal antibody (B01P)