PRDX5 polyclonal antibody (A01)
  • PRDX5 polyclonal antibody (A01)

PRDX5 polyclonal antibody (A01)

Ref: AB-H00025824-A01
PRDX5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRDX5.
Información adicional
Size 50 uL
Gene Name PRDX5
Gene Alias ACR1|AOEB166|B166|MGC117264|MGC142283|MGC142285|PLP|PMP20|PRDX6|PRXV|SBBI10
Gene Description peroxiredoxin 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRDX5 (NP_036226, 105 a.a. ~ 214 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25824

Enviar un mensaje


PRDX5 polyclonal antibody (A01)

PRDX5 polyclonal antibody (A01)