CCRN4L monoclonal antibody (M01), clone 3E8
  • CCRN4L monoclonal antibody (M01), clone 3E8

CCRN4L monoclonal antibody (M01), clone 3E8

Ref: AB-H00025819-M01
CCRN4L monoclonal antibody (M01), clone 3E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCRN4L.
Información adicional
Size 100 ug
Gene Name CCRN4L
Gene Alias CCR4L|MGC142054|MGC142060|MGC4120817|MGC78549|NOC
Gene Description CCR4 carbon catabolite repression 4-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq VCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQWNILA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCRN4L (NP_036250, 64 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25819
Clone Number 3E8
Iso type IgG2a Kappa

Enviar un mensaje


CCRN4L monoclonal antibody (M01), clone 3E8

CCRN4L monoclonal antibody (M01), clone 3E8