TNFAIP8 polyclonal antibody (A01)
  • TNFAIP8 polyclonal antibody (A01)

TNFAIP8 polyclonal antibody (A01)

Ref: AB-H00025816-A01
TNFAIP8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TNFAIP8.
Información adicional
Size 50 uL
Gene Name TNFAIP8
Gene Alias GG2-1|MDC-3.13|SCC-S2|SCCS2
Gene Description tumor necrosis factor, alpha-induced protein 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFAIP8 (AAH05352, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25816

Enviar un mensaje


TNFAIP8 polyclonal antibody (A01)

TNFAIP8 polyclonal antibody (A01)