SPDEF polyclonal antibody (A01)
  • SPDEF polyclonal antibody (A01)

SPDEF polyclonal antibody (A01)

Ref: AB-H00025803-A01
SPDEF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SPDEF.
Información adicional
Size 50 uL
Gene Name SPDEF
Gene Alias PDEF|RP11-375E1__A.3|bA375E1.3
Gene Description SAM pointed domain containing ets transcription factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPDEF (AAH21299, 1 a.a. ~ 335 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25803

Enviar un mensaje


SPDEF polyclonal antibody (A01)

SPDEF polyclonal antibody (A01)