QPCT monoclonal antibody (M02), clone 3G2
  • QPCT monoclonal antibody (M02), clone 3G2

QPCT monoclonal antibody (M02), clone 3G2

Ref: AB-H00025797-M02
QPCT monoclonal antibody (M02), clone 3G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant QPCT.
Información adicional
Size 100 ug
Gene Name QPCT
Gene Alias GCT|QC
Gene Description glutaminyl-peptide cyclotransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq PNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen QPCT (NP_036545, 262 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25797
Clone Number 3G2
Iso type IgG2b Kappa

Enviar un mensaje


QPCT monoclonal antibody (M02), clone 3G2

QPCT monoclonal antibody (M02), clone 3G2