QPCT monoclonal antibody (M01), clone 4E11
  • QPCT monoclonal antibody (M01), clone 4E11

QPCT monoclonal antibody (M01), clone 4E11

Ref: AB-H00025797-M01
QPCT monoclonal antibody (M01), clone 4E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant QPCT.
Información adicional
Size 100 ug
Gene Name QPCT
Gene Alias GCT|QC
Gene Description glutaminyl-peptide cyclotransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen QPCT (NP_036545, 262 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25797
Clone Number 4E11
Iso type IgG2a Kappa

Enviar un mensaje


QPCT monoclonal antibody (M01), clone 4E11

QPCT monoclonal antibody (M01), clone 4E11