QPCT polyclonal antibody (A01)
  • QPCT polyclonal antibody (A01)

QPCT polyclonal antibody (A01)

Ref: AB-H00025797-A01
QPCT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant QPCT.
Información adicional
Size 50 uL
Gene Name QPCT
Gene Alias GCT|QC
Gene Description glutaminyl-peptide cyclotransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen QPCT (NP_036545, 262 a.a. ~ 359 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25797

Enviar un mensaje


QPCT polyclonal antibody (A01)

QPCT polyclonal antibody (A01)